| Name |
LL-37 5-TAMRA |
| Sequence |
5-TAMRA-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| 3-letter-code |
5-TAMRA- Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser |
| N-terminus |
5-Carboxytetramethylrhodamine |
| Molecular weight |
4905.77 |
| Counter ion |
TFA |
| Solubilization |
Soluble in pure water. |
| Description |
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This peptide is labeled with 5-TAMRA at the N-terminus. |
| References |
C. C. Kietzman, G. Gao, B. Mann, L. Myers & E. I. Tuomanen. 2016.
Dynamic capsule restructuring by the main pneumococcal autolysin LytA in response to the epithelium.
Nature Communications 7, 10859, doi:10.1038/ncomms10859 |
| |
|
|
|
|
|
|
|
